UK PEPTIDE LABBatch verification

    Verified authentic

    Batch UKPL-780

    Sermorelin 5mg

    This certificate corresponds to the batch printed on your vial.

    Purity (HPLC)99.3% (spec ≥98.0%)
    Quantity in vial5.04 mg (claim 5 mg)
    CAS number86168-78-7
    Molecular weight3357.9 g/mol
    SequenceGHRH(1-29) amide — YADAIFTNSYRKVLGQLSARKLLQDIMSR-NH2
    AppearanceWhite lyophilised powder
    Storage-20°C, protected from light
    Analysis date16/07/2026
    Report date16/07/2026
    Download full Certificate of Analysis (PDF)

    This certificate corresponds to the batch number printed on your vial. For research use only. Not for human use.