Growth Hormone Secretagogues
Sermorelin
5mg
GHRH (1-29) analogue. Growth hormone secretagogue research peptide.
99.3% purity · Third-party tested · Batch UKPL-780 · View certificate
- Same-day dispatch before 3pm, Mon to Fri
- Add £41.01 more for free UK delivery
- Cold-chain shipping. Always. Dry-cold pack, Royal Mail Tracked 24
- Lost, damaged or wrong? Replaced free if you tell us within 48 hours.
- Research use only. For in-vitro laboratory research. Not for use in humans or animals, or in food, drugs or diagnostics. Not evaluated by the MHRA or FDA. The buyer is responsible for handling and regulatory compliance.
Bulk Pricing
Counted across your basket, any mix of products.
| Vials in basket | Discount | Per vial |
|---|---|---|
| 1 | None | £27.99 |
| 3-4 | 5% | £26.59 |
| 5-9 | 8% | £25.75 |
| 10-50 | 12% | £24.63 |
Bacteriostatic Water 10ml
Required to reconstitute lyophilised peptides.
What is Sermorelin?
Sermorelin, also sold as sermorelin acetate or GRF (1-29), is the first 29 amino acids of human growth-hormone-releasing hormone (GHRH) with a C-terminal amide. It is the shortest synthetic peptide with the full biological activity of GHRH. Each Sermorelin 5mg vial holds white lyophilised powder.
Full description
Sermorelin binds the GHRH receptor on somatotroph cells of the anterior pituitary and stimulates growth hormone secretion (Prakash and Goa, BioDrugs, 1999). Native GHRH has 44 residues, so sermorelin keeps the active region and drops the C-terminal third.
It was once a licensed medicine. As Geref it served as a diagnostic test of pituitary growth hormone reserve and was studied in children with idiopathic growth hormone deficiency. It was later withdrawn for commercial reasons, not because of a safety finding. No sermorelin product holds a UK marketing authorisation today.
Sermorelin Research Applications
- GHRH receptor pharmacology: the reference GHRH (1-29) agonist in somatotroph signalling and pituitary growth hormone release models.
- Analogue benchmarking: the native fragment that modified GRF (1-29) and CJC-1295 are built from.
- Ipamorelin vs sermorelin: ipamorelin acts at the ghrelin receptor, GHS-R1a, while sermorelin acts at the GHRH receptor.
- Tesamorelin vs sermorelin: both are GHRH receptor agonists, but tesamorelin keeps all 44 residues of GHRH and adds a trans-3-hexenoyl group to block enzymatic cleavage.
Study details
The human literature is diagnostic. Prakash and Goa reviewed sermorelin as a rapid and relatively specific test for growth hormone deficiency, with fewer false positives than other provocative tests. Walker (Clin Interv Aging, 2006) is a perspective article on adult growth hormone insufficiency, not a trial report.
Sermorelin vs Modified GRF (1-29)
Both use the same 29-residue backbone and the same receptor. Sermorelin is the unmodified human sequence, with three known weak points. The Tyr-Ala start is cut by dipeptidyl peptidase-4, asparagine 8 deamidates and methionine 27 oxidises. Modified GRF (1-29), also sold as CJC-1295 without DAC, swaps four residues (D-Ala2, Gln8, Ala15, Leu27) to close those routes. CJC-1295 with DAC adds an albumin-binding group on top. Sermorelin is the fragment characterised in the human diagnostic literature, so findings made with it map straight onto native GHRH (1-29). Each substitution in an analogue adds a variable.
Research Overview
Sermorelin is catalogued as GRF (1-29)-NH₂, GHRH (1-29) or hGRF (1-29). Its 1-29 backbone is the parent scaffold of a family of GHRH analogues: modified GRF (1-29) and CJC-1295 are substitution products of this exact sequence. That makes unmodified sermorelin the natural reference compound for GHRH-axis work.
Prakash and Goa (BioDrugs, 1999) reviewed its clinical use as Geref. It specifically stimulated growth hormone secretion from the anterior pituitary. As a diagnostic test for growth hormone deficiency it was rapid and relatively specific. A normal response could not rule out deficiency caused by a hypothalamic problem, so other tests were still needed in those cases.
The product was withdrawn for commercial reasons, not because of any safety finding. Walker (Clin Interv Aging, 2006) later discussed sermorelin in adult-onset growth hormone insufficiency, but that paper is a perspective piece, not trial data.
Product Specifications
- Molecular Formula
- C₁₄₉H₂₄₆N₄₄O₄₂S
- Molecular Weight
- 3357.9 g/mol
- CAS Number
- 86168-78-7
- Sequence
- YADAIFTNSYRKVLGQLSARKLLQDIMSR-NH₂ (GHRH 1-29 amide)
- Purity
- 99.3% (RP-HPLC)
- Batch
- UKPL-780
- Storage
- -20°C lyophilised, 2-8°C reconstituted
- Appearance
- White lyophilised powder
- Form
- Lyophilised powder
Certificate of Analysis
Third-party tested
- Batch
- UKPL-780
- Purity
- 99.3%
- Specification
- ≥98.0%
- Method
- RP-HPLC
- Tested
- Jul 2026
Need the certificate for an earlier batch? Request an older CoA
Storage and Reconstitution
Keep sealed vials at -20°C, away from light and moisture. After reconstitution, keep the solution at 2-8°C and use it within 4 weeks, or freeze single-use aliquots at -20°C. Oxidation of methionine 27 is the degradation route to guard against. Keep vials tightly sealed with little headspace and away from oxidising agents.
Vials are sold on their own, without bacteriostatic water for mixing or other supplies.
How to reconstitute and handle
Bring the vial to room temperature and swab both stoppers with alcohol. Add bacteriostatic water slowly down the inside wall of the vial and swirl gently until dissolved. Do not shake or vortex: a 29-residue peptide is shear-sensitive. The solution should be clear and colourless. Methionine 27 oxidises in air, so work quickly and reseal promptly. Label the vial with the date and refrigerate.
- Keep solutions away from oxidising agents and limit the time vials stand open to air.
- Work under aseptic conditions with sterile syringes and alcohol-swabbed stoppers. Split reconstituted stock into single-use aliquots and avoid repeated freeze-thaw cycles.
For the full method, see the peptide reconstitution guide and the reconstitution calculator.
Research References
- Sermorelin: a review of its use in the diagnosis and treatment of children with idiopathic growth hormone deficiency (Prakash and Goa, BioDrugs, 1999)
- Sermorelin: a better approach to management of adult-onset growth hormone insufficiency? (Walker, Clin Interv Aging, 2006)
Published research on Sermorelin is indexed on PubMed.
Sermorelin Price (UK)
Sermorelin is for sale in 2 vial sizes, priced from £27.99 for 5mg to £39.99 for 10mg. Every size ships from our UK facility, each with its own batch certificate. UK delivery is £4.50 by Royal Mail Tracked 24, free over £69.
| Vial | Price | Cost per mg | Availability |
|---|---|---|---|
| Sermorelin 5mgThis page | £27.99 | £5.60 | Very low stock |
| Sermorelin 10mg | £39.99 | £4.00Best value | In stock |
Prices are in GBP per vial and match the basket. See the FAQ for delivery and payment options, and quality & testing for how each batch is checked.
Frequently Asked Questions
How does sermorelin work?
Sermorelin binds the GHRH receptor on somatotroph cells of the anterior pituitary and stimulates release of the cells' own growth hormone. Acting at the top of the growth hormone axis is what made it useful as a diagnostic test of pituitary reserve (Prakash and Goa, BioDrugs, 1999). In the lab it serves as the reference GHRH (1-29) agonist.
Was sermorelin ever an approved medicine?
Yes. Sermorelin acetate was licensed as Geref, used to test pituitary growth hormone reserve and studied in children with idiopathic growth hormone deficiency (Prakash and Goa, BioDrugs, 1999). It was later withdrawn for commercial reasons, not because of a safety finding. No sermorelin product is a licensed medicine today, so it is supplied here as a research compound only.
What is the difference between sermorelin and GHRH?
Native human GHRH has 44 residues. Sermorelin is its first 29 residues with a C-terminal amide, the shortest fragment with full biological activity at the GHRH receptor. Because the truncation keeps the receptor pharmacology, GHRH (1-29) became the standard scaffold for analogues such as modified GRF (1-29) and CJC-1295.
Is sermorelin legal to buy in the UK?
Yes, as a research chemical for in-vitro laboratory use only. Its former licence as a diagnostic agent has lapsed, and it is not supplied for human consumption, veterinary use or any therapeutic purpose. Buyers must be 18 or over and confirm research-only use at checkout.
What is in a sermorelin vial?
Each vial holds 5mg of sermorelin as white lyophilised powder, batch UKPL-780. The peptide is C₁₄₉H₂₄₆N₄₄O₄₂S, molecular weight 3357.9 g/mol, CAS 86168-78-7. A 10mg vial is also available.
Where can I buy Sermorelin in the UK?
UK Peptide Lab sells Sermorelin 5mg from UK stock, batch UKPL-780, and a 10mg vial with its own batch. Orders placed before 3pm UK time on a working day are dispatched the same day. UK Royal Mail Tracked delivery is free over £69.
Is your Sermorelin independently tested?
Yes. Batch UKPL-780 has a third-party certificate reporting 99.3% purity by RP-HPLC. The full report is published on the product page, and its batch number matches the one printed on the vial.
What is sermorelin peptide used for in research?
Sermorelin is the native reference compound for GHRH-axis research: GHRH receptor pharmacology, somatotroph signalling and pituitary growth hormone release. Stabilised GHRH (1-29) analogues are benchmarked against it. It also has a human diagnostic literature from its time as the licensed product Geref.
Related Products
